Microneme protein 12 (Fragment)

UniProt : Q962F8, UniProt ID: Q962F8_TOXGO,

Microneme protein 12 (Fragment)

Toxoplasma gondii

VPEEEIPEGEHVPEEFPEGEHVPEEEIPEGEHVPEEEIPEGEHVPEEFPEGEHIPEELPE
GEHIPEEFPEGEHIPEELPEGEHVPEEEIPEGEHIPEEFPEGEHVPEEEIPEGEHIPEEE
FPEGEHVPEEEIPEGEHVPEEEIPEGEHVPEEELPGGELIPEEEIPEGEHVPEELPEGEH
VPEEEIPEGEHVPEELPEGEHVPEEEIPEGEHAPEEETPAPEETEKEEEEGVPVAAIAGG
VVGGVLLIAGGAGAAVYANQGGVEAAEDEVMFESEEDGTQAGENRESETVIEIEDDAWAD
MD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Microneme protein 12 (Fragment) is proteolytically cut by RHBDL2 g.p. (S54.002) cleavage..

Microneme protein 12 (Fragment) is proteolytically cut by aarA protein (S54.004) cleavage..

Microneme protein 12 (Fragment) is proteolytically cut by RHBDL2 g.p. (S54.002) cleavage..

Microneme protein 12 (Fragment) is proteolytically cut by aarA protein (S54.004) cleavage..

Microneme protein 12 (Fragment) is proteolytically cut by Rhomboid-1 (S54.001) cleavage..