Amelogenin (Fragment)

UniProt : Q9W6E9, UniProt ID: Q9W6E9_ELAQU,

Amelogenin (Fragment)

Elaphe quadrivirgata

VMTPLKWFQSIIGHQYPRYGYEPMGGWMHHNAGPMMHPPHFHGVHAIHPALHQKQPQQLP
QNPQLQQPGLNAFVPLNGHNALIPHYQHPFQPQAGEHPIQSLSPVNPMNPQQPGNANQPI
YPLPPVIPDTPLESWPADKTKKEEVD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Amelogenin (Fragment) contains a PF02948 domain.

Amelogenin (Fragment) is proteolytically cut by matrix metallopeptidase-20 (M10.019) cleavage. MGGW-MHHN.