Hemoglobin subunit alpha

UniProt : P60529, UniProt ID: HBA_CANFA,

Hemoglobin subunit alpha

Canis familiaris

VLSPADKTNIKSTWDKIGGHAGDYGGEALDRTFQSFPTTKTYFPHFDLSPGSAQVKAHGK
KVADALTTAVAHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPTEFTPA
VHASLDKFFAAVSTVLTSKYR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Hemoglobin subunit alpha contains a PF00042 domain.

Hemoglobin subunit alpha is proteolytically cut by nemepsin-2 (A01.068) cleavage. KLRV-DPVN.

Hemoglobin subunit alpha is proteolytically cut by nemepsin-2 (A01.068) cleavage. LSPG-SAQV.