Hemoglobin subunit beta

UniProt : P60524, UniProt ID: HBB_CANFA,

Hemoglobin subunit beta

Canis familiaris

VHLTAEEKSLVSGLWGKVNVDEVGGEALGRLLIVYPWTQRFFDSFGDLSTPDAVMSNAKV
KAHGKKVLNSFSDGLKNLDNLKGTFAKLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGK
EFTPQVQAAYQKVVAGVANALAHKYH

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Hemoglobin subunit beta contains a PF00042 domain.

Hemoglobin subunit beta is proteolytically cut by nemepsin-2 (A01.068) cleavage. VVAG-VANA.