Prothrombin

UniProt : P00734, UniProt ID: THRB_HUMAN,

Prothrombin

Homo sapiens

MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEEVRKGNLEREC
VEETCSYEEAFEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGTNYRGHV
NITRSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRQE
CSIPVCGQDQVTVAMTPRSEGSSVNLSPPLEQCVPDRGQQYQGRLAVTTHGLPCLAWASA
QAKALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGYCDLNYCEEAVEEETG
DGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLEDKTERELLESYI
DGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTEN
DLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHP
VCLPDRETAASLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQVVNLPIVERPVCKDST
RIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKY
GFYTHVFRLKKWIQKVIDQFGE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Prothrombin contains a PF00594 domain.

Prothrombin contains a PF00089 domain.

Prothrombin contains a PF00051 domain.

Prothrombin contains a PF00051 domain.

Prothrombin is proteolytically cut by coagulation factor Xa (S01.216) cleavage. IEGR-TATS.

Prothrombin is proteolytically cut by (S9G.027) cleavage. IDGR-IVEG.

Prothrombin is proteolytically cut by (S9G.027) cleavage. FNPR-TFGS.

Prothrombin is proteolytically cut by thrombin (S01.217) cleavage. IDGR-IVEG.

Prothrombin is proteolytically cut by thrombin (S01.217) cleavage. FNPR-TFGS.

Prothrombin is proteolytically cut by coagulation factor Xa (S01.216) cleavage. IDGR-IVEG.

Prothrombin is proteolytically cut by coagulation factor Xa (S01.216) cleavage. FNPR-TFGS.

Prothrombin is proteolytically cut by ecarin (M12.151) cleavage. RSEG-SSVN.

Prothrombin is proteolytically cut by ecarin (M12.151) cleavage. IDGR-IVEG.

Prothrombin is proteolytically cut by thrombin (S01.217) cleavage. SRTR-YERN.

Prothrombin is proteolytically cut by thrombin (S01.217) cleavage. NVGK-GQPS.

Prothrombin is proteolytically cut by thrombin (S01.217) cleavage. FVMK-SPFN.

Prothrombin is proteolytically cut by coagulation factor Xa (S01.216) cleavage. IEGR-TATS.

Prothrombin is proteolytically cut by (S9G.027) cleavage. IDGR-IVEG.

Prothrombin is proteolytically cut by (S9G.027) cleavage. FNPR-TFGS.

Prothrombin is proteolytically cut by thrombin (S01.217) cleavage. IDGR-IVEG.

Prothrombin is proteolytically cut by thrombin (S01.217) cleavage. FNPR-TFGS.

Prothrombin is proteolytically cut by coagulation factor Xa (S01.216) cleavage. IDGR-IVEG.

Prothrombin is proteolytically cut by coagulation factor Xa (S01.216) cleavage. FNPR-TFGS.

Prothrombin is proteolytically cut by ecarin (M12.151) cleavage. RSEG-SSVN.

Prothrombin is proteolytically cut by ecarin (M12.151) cleavage. IDGR-IVEG.

Prothrombin is proteolytically cut by thrombin (S01.217) cleavage. SRTR-YERN.

Prothrombin is proteolytically cut by thrombin (S01.217) cleavage. NVGK-GQPS.

Prothrombin is proteolytically cut by thrombin (S01.217) cleavage. FVMK-SPFN.

Prothrombin is proteolytically cut by thrombin (S01.217) cleavage. MTPR-SEGS.

Prothrombin is proteolytically cut by multactivase (M12.177) cleavage. IDGR-IVEG.