Hemagglutinin (Fragment)

UniProt : B2LQ64, UniProt ID: B2LQ64_9INFA,

Hemagglutinin (Fragment)

Influenza A virus (A/Champagne-Ardenne/14/2007(H3N2))

TGGICDSPHQILDGENCTLIDALLGDPQCDGFQNKKWDLFVERSKAYSNCYPYDVPDYAS
LRSLVASSGTLEFNNESFNWTGVTQNGTSSACKRGSNNSFFSRLNWLTHSKFKYPALNVT
MPNNEEFDKLYIWGVHHPGTDNDQIFLYAQASGRITVSTKRSQQTVIPNIGSRPRVRNIP
SRISIYWTIVKPGSILLINSTGNLIAPRGYFKIRSGKSSIMRSDAPIGKCNSECITPNGS
IPNDKPFQNVNRITYGACPRYVKQNTLKLATGMRNVPEKQTRGIFGAIAGFIE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Hemagglutinin (Fragment) contains a PF00509 domain.

Hemagglutinin (Fragment) is proteolytically cut by () cleavage. KQTR-GIFG.