Envelope protein (Fragment)
UniProt : B4YPL7, B4YPL8, B4YPL9, B5LG98, B5LG99, B5LGA4, UniProt ID: B4YPL7_FLV, B4YPL8_FLV, B4YPL9_FLV, B5LG98_FLV, B5LG99_FLV, B5LGA4_FLV, Envelope protein (Fragment) Feline leukemia virus SSTTGASEGGRCNPLILQFTQKGRQTSWDGPKSWGLRLYRSGYDPIALFSVSRQVMTITP PQAMGPNLVLPDQKPPSRQSQIESRVTPHHSQGNGGTPGITLVNASIAPLSTPVTPASPK RIGTGNRLINLVQGTYLALNVTNPNKTKDCWLCLVSRPPYYEGIAVLGNYSNQTNPPPSC LSDPQHKLTISEVSGQGLCIGTVPKTHQALCKKTQKGHKGTHYLAAPSGTYWACNTGLTP CISMAVLNWTSDFCVLIELWPRVTYHQPEYVYTHFAKAVRFRREPISL The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Envelope protein (Fragment) is proteolytically cut by () cleavage. RFRR-EPIS.