Homo sapiens

SGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATV
IVITLVMLKKKQYTSIHHGVVE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

is proteolytically cut by pitrilysin metallopeptidase 1 () cleavage. IIGL-MVGG.

is proteolytically cut by pitrilysin metallopeptidase 1 () cleavage. AIIG-LMVG.

is proteolytically cut by pitrilysin metallopeptidase 1 () cleavage. NKGA-IIGL.

is proteolytically cut by pitrilysin metallopeptidase 1 () cleavage. KLVF-FAED.

is proteolytically cut by pitrilysin metallopeptidase 1 () cleavage. HHQK-LVFF.

is proteolytically cut by pitrilysin metallopeptidase 1 () cleavage. VHHQ-KLVF.

is proteolytically cut by pitrilysin metallopeptidase 1 () cleavage. SNKG-AIIG.

is proteolytically cut by pitrilysin metallopeptidase 1 () cleavage. MVGG-VVIA.

is proteolytically cut by kallikrein hK6 (S01.236) cleavage. SEVK-MDAE.