Homo sapiens SGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATV IVITLVMLKKKQYTSIHHGVVE The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
is proteolytically cut by pitrilysin metallopeptidase 1 () cleavage. IIGL-MVGG.
is proteolytically cut by pitrilysin metallopeptidase 1 () cleavage. AIIG-LMVG.
is proteolytically cut by pitrilysin metallopeptidase 1 () cleavage. NKGA-IIGL.
is proteolytically cut by pitrilysin metallopeptidase 1 () cleavage. KLVF-FAED.
is proteolytically cut by pitrilysin metallopeptidase 1 () cleavage. HHQK-LVFF.
is proteolytically cut by pitrilysin metallopeptidase 1 () cleavage. VHHQ-KLVF.
is proteolytically cut by pitrilysin metallopeptidase 1 () cleavage. SNKG-AIIG.
is proteolytically cut by pitrilysin metallopeptidase 1 () cleavage. MVGG-VVIA.
is proteolytically cut by kallikrein hK6 (S01.236) cleavage. SEVK-MDAE.