MBP protein (Fragment)

UniProt : Q3SZ92, UniProt ID: Q3SZ92_BOVIN,

MBP protein (Fragment)

Bos taurus

SDELQTIQEDSAAAPGAVDAMAAQKRPSQRSKYLASASTMDHARHGFLPRHRDTGILDSL
GRFFGSDRGAPKRGSGKDGHHAARTTHYGSLPQKAQHGRPQDENPVVHFFKNIVTPRTPP
PSQGKGAEGQKPGFGYGGRASDYKSAHKGLKGHDAQGTLSKIFKLGGRDSRSGSPMARR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

MBP protein (Fragment) contains a PF01669 domain.

MBP protein (Fragment) is proteolytically cut by ADAM8 peptidase (M12.208) cleavage. GSLP-QKAQ.

MBP protein (Fragment) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage..