MBP protein (Fragment)
|
UniProt : Q3SZ92, UniProt ID: Q3SZ92_BOVIN, MBP protein (Fragment) Bos taurus SDELQTIQEDSAAAPGAVDAMAAQKRPSQRSKYLASASTMDHARHGFLPRHRDTGILDSL GRFFGSDRGAPKRGSGKDGHHAARTTHYGSLPQKAQHGRPQDENPVVHFFKNIVTPRTPP PSQGKGAEGQKPGFGYGGRASDYKSAHKGLKGHDAQGTLSKIFKLGGRDSRSGSPMARR The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
MBP protein (Fragment) contains a PF01669 domain.
MBP protein (Fragment) is proteolytically cut by ADAM8 peptidase (M12.208) cleavage. GSLP-QKAQ.
MBP protein (Fragment) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage..