Homo sapiens

RPKPQQFFGLMGKRDAGHGQISHKMAYERSAMQNYERRR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

is proteolytically cut by trepolisin (S08.024) cleavage. QQFF-GLMG.

is proteolytically cut by prolyl oligopeptidase (S09.001) cleavage. RPKP-QQFF.

is proteolytically cut by endopeptidase () cleavage. PKPQ-QFFG.

is proteolytically cut by exopeptidase () cleavage. KPQQ-FFGL.

is proteolytically cut by exopeptidase () cleavage. PQQF-FGLM.