Gurmarin

UniProt : P25810, UniProt ID: GUR_GYMSY,

Gurmarin

Gymnema sylvestre

QQCVKKDELCIPYYLDCCEPLECKKVNWWDHKCIG

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Gurmarin contains a PF06410 domain.

Gurmarin is proteolytically cut by kallikrein-2 (S01.161) cleavage. CIPY-YLDC.

Gurmarin is proteolytically cut by kallikrein 9 (S01.307) cleavage. CIPY-YLDC.