Acrosin-binding protein (Fragment)

UniProt : Q29016, UniProt ID: ACRBP_PIG,

Acrosin-binding protein (Fragment)

Sus scrofa

QLAAGSLLSLLKVLLLPLAPAPAQDANSASTPGSPLSPTEYERFFALLTPTWKAETTCRL
RATHGCRNPTLVQLDQYENHGLVPDGAVCSDLPYASWFESFCQFTQYRCSNHVYYAKRVR
CSQPVSILSPNSLKEVDTSSEVPITTMTSPVSSHITATGRQVFQPWPERLNNNVEELLQS
SLSLGGQEQGQEHKQEHKQEQGQEHKQDEGQEQEEQEEEQEEEGKQEEGQGTEESLEAMS
GLQADSEPKFQSEFVSSNPFSFTPRVREVESTPMMMENIQELIRSAQEMDEMGDVYEEEN
IWRAQSPGSLLQLPHVDALLVLCYSIVENTCVITPTAKAWQYLEDETLGFGKSVCDSLGR
RHLAACSLCDFCSLKLEQCHSETNLQRQQCDNSHKTPFISPLLASQSMSIGTQIGTLKSG
RFYGLDLYGGLRMDFWCARLATKGCEDNRVASWLQTEFLSFQDGDFPTKICDTEYVQYPN
YCAFKSQQCMMRNRDRKVSRMRCLQNETYTVLTQAKSEDLVLRWSQEFSTLTLGQAG

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Acrosin-binding protein (Fragment) contains a PF07222 domain.

Acrosin-binding protein (Fragment) is proteolytically cut by () cleavage. PALA-QDSP.

Acrosin-binding protein (Fragment) is proteolytically cut by () cleavage. ARVR-DVDS.