Gag polyprotein (Fragment)
|
UniProt : Q71B31, Q71B32, Q71B33, Q71B34, Q71B36, Q71B38, Q71B39, UniProt ID: Q71B31_9HIV1, Q71B32_9HIV1, Q71B33_9HIV1, Q71B34_9HIV1, Q71B36_9HIV1, Q71B38_9HIV1, Q71B39_9HIV1, Gag polyprotein (Fragment) Human immunodeficiency virus 1 PIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVG GHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTN NPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQE VKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARVL The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Gag polyprotein (Fragment) contains a PF00607 domain.
Gag polyprotein (Fragment) is proteolytically cut by HIV-1 retropepsin (A02.001) cleavage. NEEA-AEWD.
Gag polyprotein (Fragment) is proteolytically cut by HIV-1 retropepsin (A02.001) cleavage. TETL-LVQN.