Cell division inhibitor sulA

UniProt : Q1JQN1, UniProt ID: SULA_ECOLX,

Cell division inhibitor sulA

Escherichia coli

MYTSGYAHRSSSFSSAASKIARVSTENTTAGLISEVVYREDQPMMTQLLLLPLLQQLGQQ
SRWQLWLTPQQKLSREWVQASGLPLTKVMQISQLSPCHTVESMVRALRTGNYSVVIGWLA
DDLTEEEHAELVDAANEGNAMGFIMRPVSASSHATRQLSGLKIHSNLYH

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Cell division inhibitor sulA contains a PF03846 domain.

Cell division inhibitor sulA is proteolytically cut by Lon-A peptidase (S16.001) cleavage. ISQL-SPCH.

Cell division inhibitor sulA is proteolytically cut by Lon-A peptidase (S16.001) cleavage. QQKL-SREW.

Cell division inhibitor sulA is proteolytically cut by Lon-A peptidase (S16.001) cleavage. QLWL-TPQQ.

Cell division inhibitor sulA is proteolytically cut by Lon-A peptidase (S16.001) cleavage. LQQL-GQQS.

Cell division inhibitor sulA is proteolytically cut by Lon-A peptidase (S16.001) cleavage. TRQL-SGLK.

Cell division inhibitor sulA is proteolytically cut by Lon-A peptidase (S16.001) cleavage. WVQA-SGLP.