Phr1p

UniProt : Q9P8J6, UniProt ID: Q9P8J6_CANAL,

Phr1p

Candida albicans

MYSLIKSLVTFATLFSLTLAKFESSTPPIEVIGNKFYFSNNGSQFLIRGIAYQQDAAGSV
SSGYDADPNRKYNDPLADADACKRDVKYFKESNTNALRVYAIDPDKDHEECMKIFSDAGI
YIVADLSEPTVSINRNNPEWNLDLYKRYTKVIDKMQEYSNVLGFFAGNEVTNNRSNTDAS
AFVKAAIRDMKKYIKESDYRQIPVGYSSNDDEEIRVAIADYFSCGSLDDRADFFGINMYE
WCGKSTFETSGYKDRTEEIKNLTIPAFFSEYGCNANRPRLFQEIGTLYSDKMTDVWSGGI
VYMYFEEANKYGLVSVDGNSVKTLSDYNNYKSEMNKISPSLAHTSTLSSSDASKTLQCPG
TAASTWKAATNLPPTPDESYCDCISKSLECVVADDVDKEDYGDLFGQVCGYIDCSAISAD
GSKGEYGVASFCSDKDRLSYVLNEYYLDQDKKSSACDFKGSASINSKASASGSCKAVSGV
ATGKASSSGGSSKSGSSSASTSGSSSSSTSSGSSSSSGVKATQQMSMVKLVSIITIVTAF
VGGMSVVF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Phr1p contains a PF03198 domain.

Phr1p contains a PF07983 domain.

Phr1p is proteolytically cut by kexin (S08.070) cleavage. ACKR-DVKY.