Cysteine-rich motor neuron 1 protein

UniProt : Q9NZV1, UniProt ID: CRIM1_HUMAN,

Cysteine-rich motor neuron 1 protein

Homo sapiens

MYLVAGDRGLAGCGHLLVSLLGLLLLLARSGTRALVCLPCDESKCEEPRNCPGSIVQGVC
GCCYTCASQRNESCGGTFGIYGTCDRGLRCVIRPPLNGDSLTEYEAGVCEDENWTDDQLL
GFKPCNENLIAGCNIINGKCECNTIRTCSNPFEFPSQDMCLSALKRIEEEKPDCSKARCE
VQFSPRCPEDSVLIEGYAPPGECCPLPSRCVCNPAGCLRKVCQPGNLNILVSKASGKPGE
CCDLYECKPVFGVDCRTVECPPVQQTACPPDSYETQVRLTADGCCTLPTRCECLSGLCGF
PVCEVGSTPRIVSRGDGTPGKCCDVFECVNDTKPACVFNNVEYYDGDMFRMDNCRFCRCQ
GGVAICFTAQCGEINCERYYVPEGECCPVCEDPVYPFNNPAGCYANGLILAHGDRWREDD
CTFCQCVNGERHCVATVCGQTCTNPVKVPGECCPVCEEPTIITVDPPACGELSNCTLTGK
DCINGFKRDHNGCRTCQCINTEELCSERKQGCTLNCPFGFLTDAQNCEICECRPRPKKCR
PIICDKYCPLGLLKNKHGCDICRCKKCPELSCSKICPLGFQQDSHGCLICKCREASASAG
PPILSGTCLTVDGHHHKNEESWHDGCRECYCLNGREMCALITCPVPACGNPTIHPGQCCP
SCADDFVVQKPELSTPSICHAPGGEYFVEGETWNIDSCTQCTCHSGRVLCETEVCPPLLC
QNPSRTQDSCCPQCTDQPFRPSLSRNNSVPNYCKNDEGDIFLAAESWKPDVCTSCICIDS
VISCFSESCPSVSCERPVLRKGQCCPYCIEDTIPKKVVCHFSGKAYADEERWDLDSCTHC
YCLQGQTLCSTVSCPPLPCVEPINVEGSCCPMCPEMYVPEPTNIPIEKTNHRGEVDLEVP
LWPTPSENDIVHLPRDMGHLQVDYRDNRLHPSEDSSLDSIASVVVPIIICLSIIIAFLFI
NQKKQWIPLLCWYRTPTKPSSLNNQLVSVDCKKGTRVQVDSSQRMLRIAEPDARFSGFYS
MQKQNHLQADNFYQTV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Cysteine-rich motor neuron 1 protein contains a PF00093 domain.

Cysteine-rich motor neuron 1 protein contains a PF00093 domain.

Cysteine-rich motor neuron 1 protein contains a PF00093 domain.

Cysteine-rich motor neuron 1 protein contains a PF00093 domain.

Cysteine-rich motor neuron 1 protein contains a PF00093 domain.

Cysteine-rich motor neuron 1 protein contains a PF00093 domain.

Cysteine-rich motor neuron 1 protein contains a PF02822 domain.

Cysteine-rich motor neuron 1 protein contains a PF02822 domain.

Cysteine-rich motor neuron 1 protein contains a PF02822 domain.

Cysteine-rich motor neuron 1 protein contains a PF02822 domain.

Cysteine-rich motor neuron 1 protein is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage..