PYLa/PGLa

UniProt : Q99134, UniProt ID: PYLA_XENLA,

PYLa/PGLa

Xenopus laevis

MYKQIFLCLIIAALCATIMAEASAFADADEDDDKRYVRGMASKAGAIAGKIAKVALKALG
RRDS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

PYLa/PGLa is proteolytically cut by (M9G.026) cleavage. IAGK-IAKV.