Calpain-B

UniProt : Q9VT65, UniProt ID: CANB_DROME,

Calpain-B

Drosophila melanogaster

MYGIDNYPKNYHASGIGLVNLAALGYSKNEVSGGNEGGGAPKPKAGLYPSLPYPSSESVG
GMPYVVKQTSHAQNASYAGPTMGMGMPVPEAPSAPAPYPSATPYPGSGLYPSLPSANVSS
LPYPTAPMAPYPTGMPYPTGMPQPNLPYPAAPLAPYPSAMPGLPGMPMPYAPMPTSPAPQ
HNIGFPALPYPTAPPPESAPTQEEEPSVGVAELSFTSVKVPENQNMFWMGRKATSARQNS
VSKGDFQSLRDSCLANGTMFEDPDFPATNASLMYSRRPDRYYEWLRPGDIADDPQFFVEG
YSRFDVQQGELGDCWLLAAAANLTQDSTLFFRVIPPDQDFQENYAGIFHFKFWQYGKWVE
VVIDDRLPTYNGELIYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGTTCEAMEDFTGGV
TEWYDIKEAPPNLFSIMMKAAERGSMMGCSLEPDPHVLEAETPQGLIRGHAYSITKVCLM
DISTPNRQGKLPMIRMRNPWGNDAEWSGPWSDSSPEWRFIPEHTKEEIGLNFDRDGEFWM
SFQDFLNHFDRVEICNLSPDSLTEDQQHSSRRKWEMSMFEGEWTSGVTAGGCRNFLETFW
HNPQYIISLEDPDDEDDDGKCTAIVALMQKNRRSKRNVGIDCLTIGFAIYHLTDRDMQVK
PQGLNFFKYRASVARSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEFIIRVFSETR
NNMEENDDEVGFGETDDRIAPSLPPPTPKEEDDPQRIALRRLFDSVAGSDEEVDWQELKR
ILDHSMRDVMVGSDGFSKDAVRSMVAMLDKDRSGRLGFEEFEALLTDIAKWRAVFKLYDT
RRTGSIDGFHLRGALNSAGYHLNNRLLNALAHRYGSREGQIPFDDFLMCAIKVRTFIEMF
RERDTDNSDTAFFNLDDWLERTIYS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Calpain-B contains a PF00036 domain.

Calpain-B contains a PF00036 domain.

Calpain-B contains a PF00648 domain.

Calpain-B contains a PF01067 domain.

Calpain-B is proteolytically cut by calpain B (C02.015) cleavage. PENQ-NMFW.

Calpain-B is proteolytically cut by calpain B (C02.015) cleavage. HAQN-ASYA.