cDNA FLJ57289, highly similar to Casein kinase II subunit alpha (Casein kinase 2, alpha 1 polypeptide, isoform CRA_b)

UniProt : B4DYS6, UniProt ID: B4DYS6_HUMAN,

cDNA FLJ57289, highly similar to Casein kinase II subunit alpha (Casein kinase 2, alpha 1 polypeptide, isoform CRA_b)

Homo sapiens

MYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRY
FKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYD
YIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAR
EAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSANMMSGISSVPTPSPLGPLAGSPVIAAA
NPLGMPVPAAAGAQQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ57289, highly similar to Casein kinase II subunit alpha (Casein kinase 2, alpha 1 polypeptide, isoform CRA_b) is proteolytically cut by caspase-3 (C14.003) cleavage. DGPD-GPEE.