Prostate specific antigen

UniProt : Q8NCW4, UniProt ID: Q8NCW4_HUMAN,

Prostate specific antigen

Homo sapiens

MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWV
LTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSIE
PEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNG
VLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Prostate specific antigen contains a PF00089 domain.

Prostate specific antigen is proteolytically cut by kallikrein hK15 (S01.081) cleavage. ILSR-IVGG.

Prostate specific antigen is proteolytically cut by kallikrein hK2 (S01.161) cleavage. ILSR-IVGG.

Prostate specific antigen is proteolytically cut by kallikrein hK15 (S01.081) cleavage. ILSR-IVGG.

Prostate specific antigen is proteolytically cut by kallikrein hK2 (S01.161) cleavage. ILSR-IVGG.

Prostate specific antigen is proteolytically cut by () cleavage. LTPK-KLQC.

Prostate specific antigen is proteolytically cut by kallikrein hK4 (S01.251) cleavage. ILSR-IVGG.