Apoptosis regulator Bcl-2

UniProt : P10415, UniProt ID: BCL2_HUMAN,

Apoptosis regulator Bcl-2

Homo sapiens

MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Apoptosis regulator Bcl-2 contains a PF00452 domain.

Apoptosis regulator Bcl-2 contains a PF02180 domain.

Apoptosis regulator Bcl-2 is proteolytically cut by caspase-3 (C14.003) cleavage. DAGD-VGAA.