PMAP: SubstrateDB : Prostate specific antigen (Kallikrein 3, (Prostate specific antigen), isoform CRA_m) (cDNA, FLJ93384, Homo sapiens kallikrein 3, (prostate specific antigen) (KLK3),transcript variant 1, mRNA)

Prostate specific antigen (Kallikrein 3, (Prostate specific antigen), isoform CRA_m) (cDNA, FLJ93384, Homo sapiens kallikrein 3, (prostate specific antigen) (KLK3),transcript variant 1, mRNA)

UniProt : P07288, Q546G3, UniProt ID: KLK3_HUMAN, Q546G3_HUMAN,

Prostate specific antigen (Kallikrein 3, (Prostate specific antigen), isoform CRA_m) (cDNA, FLJ93384, Homo sapiens kallikrein 3, (prostate specific antigen) (KLK3),transcript variant 1, mRNA)

Homo sapiens

MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWV
LTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHD
LMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVIS
NDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERP
SLYTKVVHYRKWIKDTIVANP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range:	-
Cleavage position:
Cleavage residues:

Prostate specific antigen (Kallikrein 3, (Prostate specific antigen), isoform CRA_m) (cDNA, FLJ93384, Homo sapiens kallikrein 3, (prostate specific antigen) (KLK3),transcript variant 1, mRNA) contains a PF00089 domain.

Prostate specific antigen (Kallikrein 3, (Prostate specific antigen), isoform CRA_m) (cDNA, FLJ93384, Homo sapiens kallikrein 3, (prostate specific antigen) (KLK3),transcript variant 1, mRNA) is proteolytically cut by kallikrein hK15 (S01.081) cleavage. ILSR-IVGG.

Prostate specific antigen (Kallikrein 3, (Prostate specific antigen), isoform CRA_m) (cDNA, FLJ93384, Homo sapiens kallikrein 3, (prostate specific antigen) (KLK3),transcript variant 1, mRNA) is proteolytically cut by () cleavage. WIGA-APLI.

Prostate specific antigen (Kallikrein 3, (Prostate specific antigen), isoform CRA_m) (cDNA, FLJ93384, Homo sapiens kallikrein 3, (prostate specific antigen) (KLK3),transcript variant 1, mRNA) is proteolytically cut by () cleavage. LTPK-KLQC.

Prostate specific antigen (Kallikrein 3, (Prostate specific antigen), isoform CRA_m) (cDNA, FLJ93384, Homo sapiens kallikrein 3, (prostate specific antigen) (KLK3),transcript variant 1, mRNA) is proteolytically cut by kallikrein hK2 (S01.161) cleavage. ILSR-IVGG.

Prostate specific antigen (Kallikrein 3, (Prostate specific antigen), isoform CRA_m) (cDNA, FLJ93384, Homo sapiens kallikrein 3, (prostate specific antigen) (KLK3),transcript variant 1, mRNA) is proteolytically cut by kallikrein hK15 (S01.081) cleavage. ILSR-IVGG.

Prostate specific antigen (Kallikrein 3, (Prostate specific antigen), isoform CRA_m) (cDNA, FLJ93384, Homo sapiens kallikrein 3, (prostate specific antigen) (KLK3),transcript variant 1, mRNA) is proteolytically cut by () cleavage. WIGA-APLI.

Prostate specific antigen (Kallikrein 3, (Prostate specific antigen), isoform CRA_m) (cDNA, FLJ93384, Homo sapiens kallikrein 3, (prostate specific antigen) (KLK3),transcript variant 1, mRNA) is proteolytically cut by () cleavage. LTPK-KLQC.

Prostate specific antigen (Kallikrein 3, (Prostate specific antigen), isoform CRA_m) (cDNA, FLJ93384, Homo sapiens kallikrein 3, (prostate specific antigen) (KLK3),transcript variant 1, mRNA) is proteolytically cut by kallikrein hK2 (S01.161) cleavage. ILSR-IVGG.

Prostate specific antigen (Kallikrein 3, (Prostate specific antigen), isoform CRA_m) (cDNA, FLJ93384, Homo sapiens kallikrein 3, (prostate specific antigen) (KLK3),transcript variant 1, mRNA) is proteolytically cut by prostase (S01.251) cleavage. ILSR-IVGG.

Prostate specific antigen (Kallikrein 3, (Prostate specific antigen), isoform CRA_m) (cDNA, FLJ93384, Homo sapiens kallikrein 3, (prostate specific antigen) (KLK3),transcript variant 1, mRNA) is proteolytically cut by trypsin () cleavage. ILSR-IVGG.

Prostate specific antigen (Kallikrein 3, (Prostate specific antigen), isoform CRA_m) (cDNA, FLJ93384, Homo sapiens kallikrein 3, (prostate specific antigen) (KLK3),transcript variant 1, mRNA) is proteolytically cut by kallikrein hK2 (S01.161) cleavage. ILSR-IVGG.