PC cell-derived growth factor (Granulin, isoform CRA_a)

UniProt : P28799, Q540U8, UniProt ID: GRN_HUMAN, Q540U8_HUMAN,

PC cell-derived growth factor (Granulin, isoform CRA_a)

Homo sapiens

MWTLVSWVALTAGLVAGTRCPDGQFCPVACCLDPGGASYSCCRPLLDKWPTTLSRHLGGP
CQVDAHCSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGNNS
VGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCIT
PTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCC
SDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQ
SGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQAL
KRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRGS
EIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQH
CCPAGYTCNVKARSCEKEVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDNRQG
WACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

PC cell-derived growth factor (Granulin, isoform CRA_a) contains a PF00396 domain.

PC cell-derived growth factor (Granulin, isoform CRA_a) contains a PF00396 domain.

PC cell-derived growth factor (Granulin, isoform CRA_a) contains a PF00396 domain.

PC cell-derived growth factor (Granulin, isoform CRA_a) contains a PF00396 domain.

PC cell-derived growth factor (Granulin, isoform CRA_a) contains a PF00396 domain.

PC cell-derived growth factor (Granulin, isoform CRA_a) contains a PF00396 domain.

PC cell-derived growth factor (Granulin, isoform CRA_a) contains a PF00396 domain.

PC cell-derived growth factor (Granulin, isoform CRA_a) is proteolytically cut by proteinase 3 (S01.134) cleavage..

PC cell-derived growth factor (Granulin, isoform CRA_a) is proteolytically cut by proteinase 3 (S01.134) cleavage..

PC cell-derived growth factor (Granulin, isoform CRA_a) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage..

PC cell-derived growth factor (Granulin, isoform CRA_a) is proteolytically cut by proteinase 3 (S01.134) cleavage..

PC cell-derived growth factor (Granulin, isoform CRA_a) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage..

PC cell-derived growth factor (Granulin, isoform CRA_a) is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. VAGT-RCPD.

PC cell-derived growth factor (Granulin, isoform CRA_a) is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. DPQA-LKRD.

PC cell-derived growth factor (Granulin, isoform CRA_a) is proteolytically cut by proteinase 3 (S01.134) cleavage..

PC cell-derived growth factor (Granulin, isoform CRA_a) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage..

PC cell-derived growth factor (Granulin, isoform CRA_a) is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. VAGT-RCPD.

PC cell-derived growth factor (Granulin, isoform CRA_a) is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. DPQA-LKRD.

PC cell-derived growth factor (Granulin, isoform CRA_a) is proteolytically cut by neutrophil elastase (S01.131) cleavage..