Periphilin-1

UniProt : Q8K2H1, UniProt ID: PPHLN_MOUSE,

Periphilin-1

Mus musculus

MWSEGRYDYDRLPRERVPPRSHPSDGYHRVVNVVPKRPPLLDKRPPLLDKRPPLLARPDE
GGYSRYYSHVDCRVCDEGRSFSHDRRSGPSHSGDESGYRWLRDDHSTSRQPDYRDMRDGF
RRKSFYSSHYSRDRSPHKRDAPFFRESPVGRKDSPHSRSGSSVSSRSYSPERSRTHSFHQ
SQHRKSSRVGASYKRQNEAIRGRGKERSIQSVKTSRDASPSSSSAVASSKALDKPSRLTE
KELAEAESKWANETLEKSDESNLAEMNEFEAGSTAPLFIDQTEEPESNTVDGTELYEDSQ
LSNRSKAIASKTKEIEQVYRQDCETFGMVVKMLIEKDPSLEKSVQFALRQNLHEIGERCV
EELKRFITEYDNSARDFGDPF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Periphilin-1 is proteolytically cut by caspase-1 (C14.001) cleavage. NTVD-GTEL.