Profilin
|
UniProt : P07737, Q53Y44, UniProt ID: PROF1_HUMAN, Q53Y44_HUMAN, Profilin Homo sapiens MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFY VNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVH GGLINKKCYEMASHLRRSQY The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Profilin contains a PF00235 domain.
Profilin is proteolytically cut by calpain-2 (C02.002) cleavage..
Profilin is proteolytically cut by caspase-3 (C14.003) cleavage..
Profilin is proteolytically cut by calpain-2 (C02.002) cleavage..
Profilin is proteolytically cut by caspase-3 (C14.003) cleavage..
Profilin is proteolytically cut by chymase (S01.140) cleavage. PSVW-AAVP.