Putative uncharacterized protein PROC (Protein C) (Inactivator of coagulation factors Va and VIIIa)

UniProt : P04070, Q53S74, UniProt ID: PROC_HUMAN, Q53S74_HUMAN,

Putative uncharacterized protein PROC (Protein C) (Inactivator of coagulation factors Va and VIIIa)

Homo sapiens

MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERECI
EEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSC
DCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVK
FPCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLDSKKKLACGA
VLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIKEVFVHPNYSKSTTDNDI
ALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVL
NFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLV
SWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAPQKSWAP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein PROC (Protein C) (Inactivator of coagulation factors Va and VIIIa) contains a PF00008 domain.

Putative uncharacterized protein PROC (Protein C) (Inactivator of coagulation factors Va and VIIIa) contains a PF00008 domain.

Putative uncharacterized protein PROC (Protein C) (Inactivator of coagulation factors Va and VIIIa) contains a PF00089 domain.

Putative uncharacterized protein PROC (Protein C) (Inactivator of coagulation factors Va and VIIIa) contains a PF00594 domain.

Putative uncharacterized protein PROC (Protein C) (Inactivator of coagulation factors Va and VIIIa) is proteolytically cut by thrombin (S01.217) cleavage. VDPR-LIDG.

Putative uncharacterized protein PROC (Protein C) (Inactivator of coagulation factors Va and VIIIa) is proteolytically cut by russellysin (M12.158) cleavage. IRKR-ANSF.

Putative uncharacterized protein PROC (Protein C) (Inactivator of coagulation factors Va and VIIIa) is proteolytically cut by furin (S08.071) cleavage. HLKR-DTED.