Putative uncharacterized protein

UniProt : O60595, UniProt ID: O60595_HUMAN,

Putative uncharacterized protein

Homo sapiens

MWPPGSASQPPPSPAAATGLHPAARPVSLQCRLSMCPARSLLLVATLVLLDHLSLARNLP
VATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACL
PLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLL
MDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRA
VTIDRVMSYLNAS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein contains a PF03039 domain.

Putative uncharacterized protein is proteolytically cut by gingipain R (C25.001) cleavage..

Putative uncharacterized protein is proteolytically cut by gingipain K (C25.002) cleavage..