PMAP: SubstrateDB : Biglycan

Biglycan

UniProt : P21810, UniProt ID: PGS1_HUMAN,

Biglycan

Homo sapiens

MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYS
AMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALV
LVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFS
GLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNK
IQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLK
LLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLA
IQFGNYKK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range:	-
Cleavage position:
Cleavage residues:

Biglycan contains a PF01462 domain.

Biglycan contains a PF00560 domain.

Biglycan is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. RNMN-CIEM.

Biglycan is proteolytically cut by ADAMTS5 peptidase (M12.225) cleavage. RNMN-CIEM.

Biglycan is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. RNMN-CIEM.

Biglycan is proteolytically cut by ADAMTS5 peptidase (M12.225) cleavage. RNMN-CIEM.

Biglycan is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. ISEA-KLTG.

Biglycan is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. NELH-LDHN.

Biglycan is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. TLRE-LHLD.

Biglycan is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. VPSG-LPDL.

Biglycan is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. NPLE-NSGF.

Biglycan is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. LKLN-YLRI.

Biglycan is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. KLNY-LRIS.

Biglycan is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. NPLE-NSGF.

Biglycan is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. SEAK-LTGI.

Biglycan is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. SDLG-LKSV.

Biglycan is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. DISE-LRKD.

Biglycan is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. DISE-LRKD.

Biglycan is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. SDLG-LKSV.

Biglycan is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. SEAK-LTGI.

Biglycan is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. LPET-LNEL.

Biglycan is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. SEAK-LTGI.

Biglycan is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. SEAK-LTGI.

Biglycan is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. QAIE-LEDL.

Biglycan is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. FGVK-RAYY.

Biglycan is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. NPVP-YWEV.

Biglycan is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. DISE-LRKD.

Biglycan is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. LGLK-SVPK.

Biglycan is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. DLGL-KSVP.

Biglycan is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. KLNY-LRIS.