KLK13 (Kallikrein 13, isoform CRA_a)
|
UniProt : A7UNK6, Q9UKR3, UniProt ID: A7UNK6_HUMAN, KLK13_HUMAN, KLK13 (Kallikrein 13, isoform CRA_a) Homo sapiens MWPLALVIASLTLALSGGVSQESSKVLNTNGTSGFLPGGYTCFPHSQPWQAALLVQGRLL CGGVLVHPKWVLTAAHCLKEGLKVYLGKHALGRVEAGEQVREVVHSIPHPEYRRSPTHLN HDHDIMLLELQSPVQLTGYIQTLPLSHNNRLTPGTTCRVSGWGTTTSPQVNYPKTLQCAN IQLRSDEECRQVYPGKITDNMLCAGTKEGGKDSCEGDSGGPLVCNRTLYGIVSWGDFPCG QPDRPGVYTRVSRYVLWIRETIRKYETQQQKWLKGPQ The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
KLK13 (Kallikrein 13, isoform CRA_a) contains a PF00089 domain.
KLK13 (Kallikrein 13, isoform CRA_a) is proteolytically cut by kallikrein hK13 (S01.306) cleavage. EYRR-SPTH.