KLK13 (Kallikrein 13, isoform CRA_a)

UniProt : A7UNK6, Q9UKR3, UniProt ID: A7UNK6_HUMAN, KLK13_HUMAN,

KLK13 (Kallikrein 13, isoform CRA_a)

Homo sapiens

MWPLALVIASLTLALSGGVSQESSKVLNTNGTSGFLPGGYTCFPHSQPWQAALLVQGRLL
CGGVLVHPKWVLTAAHCLKEGLKVYLGKHALGRVEAGEQVREVVHSIPHPEYRRSPTHLN
HDHDIMLLELQSPVQLTGYIQTLPLSHNNRLTPGTTCRVSGWGTTTSPQVNYPKTLQCAN
IQLRSDEECRQVYPGKITDNMLCAGTKEGGKDSCEGDSGGPLVCNRTLYGIVSWGDFPCG
QPDRPGVYTRVSRYVLWIRETIRKYETQQQKWLKGPQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

KLK13 (Kallikrein 13, isoform CRA_a) contains a PF00089 domain.

KLK13 (Kallikrein 13, isoform CRA_a) is proteolytically cut by kallikrein hK13 (S01.306) cleavage. EYRR-SPTH.