Zona pellucida sperm-binding protein 4

UniProt : Q07287, UniProt ID: ZP4_PIG,

Zona pellucida sperm-binding protein 4

Sus scrofa

MWLRPSIWLCFPLCLALPGQSQPKAADDLGGLYCGPSSFHFSINLLSQDTATPPALVVWD
RRGRLHKLQNDSGCGTWVHKGPGSSMGVEASYRGCYVTEWDSHYLMPIGLEEADAGGHRT
VTETKLFKCPVDFLALDVPTIGLCDAVPVWDRLPCAPPPITQGECKQLGCCYNSEEVPSC
YYGNTVTSRCTQDGHFSIAVSRNVTSPPLLWDSVHLAFRNDSECKPVMETHTFVLFRFPF
SSCGTAKRVTGNQAVYENELVAARDVRTWSHGSITRDSIFRLRVSCIYSVSSSALPVNIQ
VFTLPPPLPETHPGPLTLELQIAKDERYGSYYNASDYPVVKLLREPIYVEVSIRHRTDPS
LGLHLHQCWATPGMSPLLQPQWPMLVNGCPYTGDNYQTKLIPVQKASNLLFPSHYQRFSV
STFSFVDSVAKQALKGPVYLHCTASVCKPAGAPICVTTCPAARRRRSSDIHFQNGTASIS
SKGPMILLQATRDSSERLHKYSRPPVDSHALWVAGLLGSLIIGALLVSYLVFRKWR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Zona pellucida sperm-binding protein 4 contains a PF00088 domain.

Zona pellucida sperm-binding protein 4 contains a PF00100 domain.

Zona pellucida sperm-binding protein 4 is proteolytically cut by furin (S08.071) cleavage. RRRR-SSDI.