Granulocyte-macrophage colony-stimulating factor

UniProt : P04141, UniProt ID: CSF2_HUMAN,

Granulocyte-macrophage colony-stimulating factor

Homo sapiens

MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVI
SEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITF
ESFKENLKDFLLVIPFDCWEPVQE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Granulocyte-macrophage colony-stimulating factor contains a PF01109 domain.

Granulocyte-macrophage colony-stimulating factor is proteolytically cut by tripeptidyl-peptidase A (S33.002) cleavage. -APA-RSPS.