Lipase, gastric (Lipase, gastric, isoform CRA_b) (cDNA, FLJ93392, Homo sapiens lipase, gastric (LIPF), mRNA)

UniProt : P07098, Q5VXI7, UniProt ID: LIPG_HUMAN, Q5VXI7_HUMAN,

Lipase, gastric (Lipase, gastric, isoform CRA_b) (cDNA, FLJ93392, Homo sapiens lipase, gastric (LIPF), mRNA)

Homo sapiens

MWLLLTMASLISVLGTTHGLFGKLHPGSPEVTMNISQMITYWGYPNEEYEVVTEDGYILE
VNRIPYGKKNSGNTGQRPVVFLQHGLLASATNWISNLPNNSLAFILADAGYDVWLGNSRG
NTWARRNLYYSPDSVEFWAFSFDEMAKYDLPATIDFIVKKTGQKQLHYVGHSQGTTIGFI
AFSTNPSLAKRIKTFYALAPVATVKYTKSLINKLRFVPQSLFKFIFGDKIFYPHNFFDQF
LATEVCSREMLNLLCSNALFIICGFDSKNFNTSRLDVYLSHNPAGTSVQNMFHWTQAVKS
GKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDLLADPQDVGLLLPKLPN
LIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDKK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Lipase, gastric (Lipase, gastric, isoform CRA_b) (cDNA, FLJ93392, Homo sapiens lipase, gastric (LIPF), mRNA) contains a PF00561 domain.

Lipase, gastric (Lipase, gastric, isoform CRA_b) (cDNA, FLJ93392, Homo sapiens lipase, gastric (LIPF), mRNA) contains a PF04083 domain.

Lipase, gastric (Lipase, gastric, isoform CRA_b) (cDNA, FLJ93392, Homo sapiens lipase, gastric (LIPF), mRNA) is proteolytically cut by trypsin () cleavage. LFGK-LHPG.

Lipase, gastric (Lipase, gastric, isoform CRA_b) (cDNA, FLJ93392, Homo sapiens lipase, gastric (LIPF), mRNA) is proteolytically cut by () cleavage. TTHG-LFGK.