Putative uncharacterized protein

UniProt : P49710, Q542G0, UniProt ID: HCLS1_MOUSE, Q542G0_MOUSE,

Putative uncharacterized protein

Mus musculus

MWKSVVGHDVSVSVETQGDDWDTDPDFVNDISEKEQRWGAKTIEGSGRTEHINIHQLRNK
VSEEHDILKKKELESGPKASHGYGGQFGVERDRMDKSAVGHEYVADVEKHSSQTDAARGF
GGKYGVERDRADKSAVGFDYKGEVEKHASQKDYSHGFGGRYGVEKDKRDKAALGYDYKGE
TEKHESQRDYAKGFGGQYGIQKDRVDKSAVGFNEMEAPTTAYKKTTPIEAASSGARGLKA
KFESLAEEKRKREEEEKAQQMARQQQERKAVVKMSREVQQPSMPVEEPAAPAQLPKKISS
EVWPPAESHLPPESQPVRSRREYPVPSLPTRQSPLQNHLEDNEEPPALPPRTPEGLQVVE
EPVYEAAPELEPEPEPDYEPEPETEPDYEDVGELDRQDEDAEGDYEDVLEPEDTPSLSYQ
AGPSAGAGGAGISAIALYDYQGEGSDELSFDPDDIITDIEMVDEGWWRGQCRGHFGLFPA
NYVKLL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein contains a PF00018 domain.

Putative uncharacterized protein contains a PF02218 domain.

Putative uncharacterized protein contains a PF02218 domain.

Putative uncharacterized protein contains a PF02218 domain.

Putative uncharacterized protein contains a PF02218 domain.

Putative uncharacterized protein is proteolytically cut by caspase-1 (C14.001) cleavage. DYSH-GFGG.