Follistatin-related protein 1

UniProt : Q12841, UniProt ID: FSTL1_HUMAN,

Follistatin-related protein 1

Homo sapiens

MWKRWLALALALVAVAWVRAEEELRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKP
HKRPVCGSNGKTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQSNRDE
LRRRIIQWLEAEIIPDGWFSKGSNYSEILDKYFKNFDNGDSRLDSSEFLKFVEQNETAIN
ITTYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETY
ADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTEEEMTRYVQELQKHQETAEKT
KRVSTKEI

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Follistatin-related protein 1 contains a PF00036 domain.

Follistatin-related protein 1 contains a PF00036 domain.

Follistatin-related protein 1 contains a PF07648 domain.

Follistatin-related protein 1 contains a PF09120 domain.

Follistatin-related protein 1 is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. PEKK-CALE.

Follistatin-related protein 1 is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. EFLK-CLNP.

Follistatin-related protein 1 is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. SNGK-TYLN.

Follistatin-related protein 1 is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. SKSK-ICAN.

Follistatin-related protein 1 is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. LRSK-SKIC.