1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1

UniProt : P10686, UniProt ID: PLCG1_RAT,

1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1

Rattus norvegicus

MAGVGTPCANGCGPSAPSEAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGADKIEGSIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTL
SLQATSEDEVNMWIKGLTWLMEDTLQAATPLQIERWLRKQFYSVDRNREDRISAKDLKNM
LSQVNYRVPNMRFLRERLTDFEQRSGDITYGQFAQLYRSLMYSAQKTMDLPFLETNTLRT
GERPELCQVSLSEFQQFLLEYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFFLDELVT
FLFSKENSVWNSQLDAVCPETMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMG
CRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQHFRKVLGDTLLTKPVDIAADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSVM
YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEASG
STELHSSEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFW
RNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQT
NAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQE
GQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNP
GFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQDGGWWRGDYGGKKQLW
FPSNYVEEMINPAILEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSIS
MPSVAQWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKMMERRKKIALELSELVVYC
RPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDS
SNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMAGGHCGYVLQPSTMRDEAFDPFDKS
SLRGLEPCVICIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSTKQKTEFVVDNGLNPVW
PAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDL
ELASLLIKIDIFPAKENGDLSPFSGTSLRERASDASSQLFHVRAREGSFEARYQQPFEDF
RISQEHLADHFDSRERRAPRRTRVNGDNRL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1 contains a PF00017 domain.

1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1 contains a PF00168 domain.

1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1 contains a PF00387 domain.

1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1 contains a PF00388 domain.

1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1 contains a PF00169 domain.

1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1 contains a PF00018 domain.

1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1 contains a PF00017 domain.

1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1 is proteolytically cut by caspase-3 (C14.003) cleavage. AEPD-YGAL.

1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1 is proteolytically cut by caspase-7 (C14.004) cleavage..