Proteinase-activated receptor 4

UniProt : Q96RI0, UniProt ID: PAR4_HUMAN,

Proteinase-activated receptor 4

Homo sapiens

MWGRLLLWPLVLGFSLSGGTQTPSVYDESGSTGGGDDSTPSILPAPRGYPGQVCANDSDT
LELPDSSRALLLGWVPTRLVPALYGLVLVVGLPANGLALWVLATQAPRLPSTMLLMNLAA
ADLLLALALPPRIAYHLRGQRWPFGEAACRLATAALYGHMYGSVLLLAAVSLDRYLALVH
PLRARALRGRRLALGLCMAAWLMAAALALPLTLQRQTFRLARSDRVLCHDALPLDAQASH
WQPAFTCLALLGCFLPLLAMLLCYGATLHTLAASGRRYGHALRLTAVVLASAVAFFVPSN
LLLLLHYSDPSPSAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSAEFRDKVRAGLFQRSP
GDTVASKASAEGGSRGMGTHSSLLQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Proteinase-activated receptor 4 contains a PF00001 domain.

Proteinase-activated receptor 4 is proteolytically cut by gingipain R (C25.001) cleavage..

Proteinase-activated receptor 4 is proteolytically cut by gingipain R2 (C25.003) cleavage..

Proteinase-activated receptor 4 is proteolytically cut by trypsin 1 (S01.151) cleavage. PAPR-GYPG.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK14 (S01.029) cleavage. PRGY-PGQV.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK14 (S01.029) cleavage. TGGG-DDST.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK14 (S01.029) cleavage. PAPR-GYPG.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK5 (S01.017) cleavage. PAPR-GYPG.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK5 (S01.017) cleavage. GYPG-QVCA.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK5 (S01.017) cleavage. TGGG-DDST.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK5 (S01.017) cleavage. GGGD-DSTP.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK5 (S01.017) cleavage. GGDD-STPS.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK6 (S01.236) cleavage. PAPR-GYPG.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK6 (S01.236) cleavage. PRGY-PGQV.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK6 (S01.236) cleavage. TGGG-DDST.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK6 (S01.236) cleavage. DDST-PSIL.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK6 (S01.236) cleavage. DSTP-SILP.

Proteinase-activated receptor 4 is proteolytically cut by trypsin () cleavage. PAPR-GYPG.

Proteinase-activated receptor 4 is proteolytically cut by plasmin (S01.233) cleavage. PAPR-GYPG.

Proteinase-activated receptor 4 is proteolytically cut by gingipain R (C25.001) cleavage..

Proteinase-activated receptor 4 is proteolytically cut by gingipain R2 (C25.003) cleavage..

Proteinase-activated receptor 4 is proteolytically cut by trypsin 1 (S01.151) cleavage. PAPR-GYPG.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK14 (S01.029) cleavage. PRGY-PGQV.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK14 (S01.029) cleavage. TGGG-DDST.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK14 (S01.029) cleavage. PAPR-GYPG.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK5 (S01.017) cleavage. PAPR-GYPG.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK5 (S01.017) cleavage. GYPG-QVCA.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK5 (S01.017) cleavage. TGGG-DDST.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK5 (S01.017) cleavage. GGGD-DSTP.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK5 (S01.017) cleavage. GGDD-STPS.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK6 (S01.236) cleavage. PAPR-GYPG.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK6 (S01.236) cleavage. PRGY-PGQV.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK6 (S01.236) cleavage. TGGG-DDST.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK6 (S01.236) cleavage. DDST-PSIL.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK6 (S01.236) cleavage. DSTP-SILP.

Proteinase-activated receptor 4 is proteolytically cut by trypsin () cleavage. PAPR-GYPG.

Proteinase-activated receptor 4 is proteolytically cut by plasmin (S01.233) cleavage. PAPR-GYPG.

Proteinase-activated receptor 4 is proteolytically cut by thrombin (S01.217) cleavage. PAPR-GYPG.

Proteinase-activated receptor 4 is proteolytically cut by gingipain R (C25.001) cleavage..

Proteinase-activated receptor 4 is proteolytically cut by gingipain R2 (C25.003) cleavage..

Proteinase-activated receptor 4 is proteolytically cut by trypsin 1 (S01.151) cleavage. PAPR-GYPG.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK14 (S01.029) cleavage. PRGY-PGQV.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK14 (S01.029) cleavage. TGGG-DDST.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK14 (S01.029) cleavage. PAPR-GYPG.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK5 (S01.017) cleavage. PAPR-GYPG.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK5 (S01.017) cleavage. GYPG-QVCA.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK5 (S01.017) cleavage. TGGG-DDST.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK5 (S01.017) cleavage. GGGD-DSTP.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK5 (S01.017) cleavage. GGDD-STPS.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK6 (S01.236) cleavage. PAPR-GYPG.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK6 (S01.236) cleavage. PRGY-PGQV.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK6 (S01.236) cleavage. TGGG-DDST.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK6 (S01.236) cleavage. DDST-PSIL.

Proteinase-activated receptor 4 is proteolytically cut by kallikrein hK6 (S01.236) cleavage. DSTP-SILP.

Proteinase-activated receptor 4 is proteolytically cut by trypsin () cleavage. PAPR-GYPG.

Proteinase-activated receptor 4 is proteolytically cut by plasmin (S01.233) cleavage. PAPR-GYPG.

Proteinase-activated receptor 4 is proteolytically cut by thrombin (S01.217) cleavage. PAPR-GYPG.

Proteinase-activated receptor 4 is proteolytically cut by thrombin (S01.217) cleavage. PAPR-GYPG.