Lens fiber major intrinsic protein

UniProt : P30301, UniProt ID: MIP_HUMAN,

Lens fiber major intrinsic protein

Homo sapiens

MWELRSASFWRAIFAEFFATLFYVFFGLGSSLRWAPGPLHVLQVAMAFGLALATLVQSVG
HISGAHVNPAVTFAFLVGSQMSLLRAFCYMAAQLLGAVAGAAVLYSVTPPAVRGNLALNT
LHPAVSVGQATTVEIFLTLQFVLCIFATYDERRNGQLGSVALAVGFSLALGHLFGMYYTG
AGMNPARSFAPAILTGNFTNHWVYWVGPIIGGGLGSLLYDFLLFPRLKSISERLSVLKGA
KPDVSNGQPEVTGEPVELNTQAL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Lens fiber major intrinsic protein contains a PF00230 domain.

Lens fiber major intrinsic protein is proteolytically cut by calpain-2 (C02.002) cleavage. SVLK-GAKP.

Lens fiber major intrinsic protein is proteolytically cut by calpain-2 (C02.002) cleavage. PEVT-GEPV.

Lens fiber major intrinsic protein is proteolytically cut by calpain-2 (C02.002) cleavage. VELN-TQAL.

Lens fiber major intrinsic protein is proteolytically cut by calpain-2 (C02.002) cleavage. ELNT-QAL-.