Kallikrein-2

UniProt : P20151, UniProt ID: KLK2_HUMAN,

Kallikrein-2

Homo sapiens

MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWV
LTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHD
LMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLS
NDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKP
AVYTKVVHYRKWIKDTIAANP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Kallikrein-2 contains a PF00089 domain.

Kallikrein-2 is proteolytically cut by () cleavage. CTGA-VPLI.

Kallikrein-2 is proteolytically cut by () cleavage. IQSR-IVGG.

Kallikrein-2 is proteolytically cut by () cleavage. CTGA-VPLI.

Kallikrein-2 is proteolytically cut by () cleavage. IQSR-IVGG.

Kallikrein-2 is proteolytically cut by kallikrein hK2 (S01.161) cleavage. LRPR-SLQC.

Kallikrein-2 is proteolytically cut by kallikrein hK2 (S01.161) cleavage. IQSR-IVGG.

Kallikrein-2 is proteolytically cut by kallikrein hK2 (S01.161) cleavage. VHYR-KWIK.

Kallikrein-2 is proteolytically cut by trypsin () cleavage. IQSR-IVGG.

Kallikrein-2 is proteolytically cut by trypsin () cleavage. VHYR-KWIK.

Kallikrein-2 is proteolytically cut by kallikrein hK3 (S01.162) cleavage. VHYR-KWIK.

Kallikrein-2 is proteolytically cut by kallikrein hK3 (S01.162) cleavage. IQSR-IVGG.

Kallikrein-2 is proteolytically cut by () cleavage. CTGA-VPLI.

Kallikrein-2 is proteolytically cut by () cleavage. IQSR-IVGG.

Kallikrein-2 is proteolytically cut by kallikrein hK2 (S01.161) cleavage. LRPR-SLQC.

Kallikrein-2 is proteolytically cut by kallikrein hK2 (S01.161) cleavage. IQSR-IVGG.

Kallikrein-2 is proteolytically cut by kallikrein hK2 (S01.161) cleavage. VHYR-KWIK.

Kallikrein-2 is proteolytically cut by trypsin () cleavage. IQSR-IVGG.

Kallikrein-2 is proteolytically cut by trypsin () cleavage. VHYR-KWIK.

Kallikrein-2 is proteolytically cut by kallikrein hK3 (S01.162) cleavage. VHYR-KWIK.

Kallikrein-2 is proteolytically cut by kallikrein hK3 (S01.162) cleavage. IQSR-IVGG.

Kallikrein-2 is proteolytically cut by kallikrein hK2 (S01.161) cleavage. IQSR-IVGG.