Thrombospondin 2 (Thrombospondin 2, isoform CRA_c) (cDNA FLJ76944, highly similar to Homo sapiens thrombospondin 2 (THBS2), mRNA)

UniProt : Q5RI52, UniProt ID: Q5RI52_HUMAN,

Thrombospondin 2 (Thrombospondin 2, isoform CRA_c) (cDNA FLJ76944, highly similar to Homo sapiens thrombospondin 2 (THBS2), mRNA)

Homo sapiens

MVWRLVLLALWVWPSTQAGHQDKDTTFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRF
DYIPPVNADDLSKITKIMRQKEGFFLTAQLKQDGKSRGTLLALEGPGLSQRQFEIVSNGP
ADTLDLTYWIDGTRHVVSLEDVGLADSQWKNVTVQVAGETYSLHVGCDLIDSFALDEPFY
EHLQAEKSRMYVAKGSARESHFRGLLQNVHLVFENSVEDILSKKGCQQGQGAEINAISEN
TETLRLGPHVTTEYVGPSSERRPEVCERSCEELGNMVQELSGLHVLVNQLSENLKRVSND
NQFLWELIGGPPKTRNMSACWQDGRFFAENETWVVDSCTTCTCKKFKTICHQITCPPATC
ASPSFVEGECCPSCLHSVDGEEGWSPWAEWTQCSVTCGSGTQQRGRSCDVTSNTCLGPSI
QTRACSLSKCDTRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLCNSPVPQMGGKNCKGSG
RETKACQGAPCPIDGRWSPWSPWSACTVTCAGGIRERTRVCNSPEPQYGGKACVGDVQER
QMCNKRSCPVDGCLSNPCFPGAQCSSFPDGSWSCGSCPVGFLGNGTHCEDLDECALVPDI
CFSTSKVPRCVNTQPGFHCLPCPPRYRGNQPVGVGLEAAKTEKQVCEPENPCKDKTHNCH
KHAECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNLNLVCATNATYHCIKDNC
PHLPNSGQEDFDKDGIGDACDDDDDNDGVTDEKDNCQLLFNPRQADYDKDEVGDRCDNCP
YVHNPAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPL
VHNPDQTDVDNDLVGDQCDNNEDIDDDGHQNNQDNCPYISNANQADHDRDGQGDACDPDD
DNDGVPDDRDNCRLVFNPDQEDLDGDGRGDICKDDFDNDNIPDIDDVCPENNAISETDFR
NFQMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDR
DDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEDQPTRAYGYSGVSLKVVNSTTGTGEHLRN
ALWHTGNTPGQVRTLWHDPRNIGWKDYTAYRWHLTHRPKTGYIRVLVHEGKQVMADSGPI
YDQTYAGGRLGLFVFSQEMVYFSDLKYECRDI

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Thrombospondin 2 (Thrombospondin 2, isoform CRA_c) (cDNA FLJ76944, highly similar to Homo sapiens thrombospondin 2 (THBS2), mRNA) contains a PF00008 domain.

Thrombospondin 2 (Thrombospondin 2, isoform CRA_c) (cDNA FLJ76944, highly similar to Homo sapiens thrombospondin 2 (THBS2), mRNA) contains a PF00090 domain.

Thrombospondin 2 (Thrombospondin 2, isoform CRA_c) (cDNA FLJ76944, highly similar to Homo sapiens thrombospondin 2 (THBS2), mRNA) contains a PF00090 domain.

Thrombospondin 2 (Thrombospondin 2, isoform CRA_c) (cDNA FLJ76944, highly similar to Homo sapiens thrombospondin 2 (THBS2), mRNA) contains a PF00090 domain.

Thrombospondin 2 (Thrombospondin 2, isoform CRA_c) (cDNA FLJ76944, highly similar to Homo sapiens thrombospondin 2 (THBS2), mRNA) contains a PF00093 domain.

Thrombospondin 2 (Thrombospondin 2, isoform CRA_c) (cDNA FLJ76944, highly similar to Homo sapiens thrombospondin 2 (THBS2), mRNA) contains a PF02412 domain.

Thrombospondin 2 (Thrombospondin 2, isoform CRA_c) (cDNA FLJ76944, highly similar to Homo sapiens thrombospondin 2 (THBS2), mRNA) contains a PF02412 domain.

Thrombospondin 2 (Thrombospondin 2, isoform CRA_c) (cDNA FLJ76944, highly similar to Homo sapiens thrombospondin 2 (THBS2), mRNA) contains a PF02412 domain.

Thrombospondin 2 (Thrombospondin 2, isoform CRA_c) (cDNA FLJ76944, highly similar to Homo sapiens thrombospondin 2 (THBS2), mRNA) contains a PF02412 domain.

Thrombospondin 2 (Thrombospondin 2, isoform CRA_c) (cDNA FLJ76944, highly similar to Homo sapiens thrombospondin 2 (THBS2), mRNA) contains a PF02412 domain.

Thrombospondin 2 (Thrombospondin 2, isoform CRA_c) (cDNA FLJ76944, highly similar to Homo sapiens thrombospondin 2 (THBS2), mRNA) contains a PF02412 domain.

Thrombospondin 2 (Thrombospondin 2, isoform CRA_c) (cDNA FLJ76944, highly similar to Homo sapiens thrombospondin 2 (THBS2), mRNA) contains a PF02412 domain.

Thrombospondin 2 (Thrombospondin 2, isoform CRA_c) (cDNA FLJ76944, highly similar to Homo sapiens thrombospondin 2 (THBS2), mRNA) contains a PF02412 domain.

Thrombospondin 2 (Thrombospondin 2, isoform CRA_c) (cDNA FLJ76944, highly similar to Homo sapiens thrombospondin 2 (THBS2), mRNA) contains a PF02412 domain.

Thrombospondin 2 (Thrombospondin 2, isoform CRA_c) (cDNA FLJ76944, highly similar to Homo sapiens thrombospondin 2 (THBS2), mRNA) contains a PF02412 domain.

Thrombospondin 2 (Thrombospondin 2, isoform CRA_c) (cDNA FLJ76944, highly similar to Homo sapiens thrombospondin 2 (THBS2), mRNA) contains a PF02412 domain.

Thrombospondin 2 (Thrombospondin 2, isoform CRA_c) (cDNA FLJ76944, highly similar to Homo sapiens thrombospondin 2 (THBS2), mRNA) contains a PF02412 domain.

Thrombospondin 2 (Thrombospondin 2, isoform CRA_c) (cDNA FLJ76944, highly similar to Homo sapiens thrombospondin 2 (THBS2), mRNA) contains a PF05735 domain.

Thrombospondin 2 (Thrombospondin 2, isoform CRA_c) (cDNA FLJ76944, highly similar to Homo sapiens thrombospondin 2 (THBS2), mRNA) contains a PF07645 domain.

Thrombospondin 2 (Thrombospondin 2, isoform CRA_c) (cDNA FLJ76944, highly similar to Homo sapiens thrombospondin 2 (THBS2), mRNA) is proteolytically cut by ADAMTS1 peptidase (M12.222) cleavage. FLWE-LIGG.