Neural cell adhesion molecule L1

UniProt : P11627, UniProt ID: L1CAM_MOUSE,

Neural cell adhesion molecule L1

Mus musculus

MVVMLRYVWPLLLCSPCLLIQIPDEYKGHHVLEPPVITEQSPRRLVVFPTDDISLKCEAR
GRPQVEFRWTKDGIHFKPKEELGVVVHEAPYSGSFTIEGNNSFAQRFQGIYRCYASNKLG
TAMSHEIQLVAEGAPKWPKETVKPVEVEEGESVVLPCNPPPSAAPPRIYWMNSKIFDIKQ
DERVSMGQNGDLYFANVLTSDNHSDYICNAHFPGTRTIIQKEPIDLRVKPTNSMIDRKPR
LLFPTNSSSRLVALQGQSLILECIAEGFPTPTIKWLHPSDPMPTDRVIYQNHNKTLQLLN
VGEEDDGEYTCLAENSLGSARHAYYVTVEAAPYWLQKPQSHLYGPGETARLDCQVQGRPQ
PEITWRINGMSMETVNKDQKYRIEQGSLILSNVQPTDTMVTQCEARNQHGLLLANAYIYV
VQLPARILTKDNQTYMAVEGSTAYLLCKAFGAPVPSVQWLDEEGTTVLQDERFFPYANGT
LSIRDLQANDTGRYFCQAANDQNNVTILANLQVKEATQITQGPRSAIEKKGARVTFTCQA
SFDPSLQASITWRGDGRDLQERGDSDKYFIEDGKLVIQSLDYSDQGNYSCVASTELDEVE
SRAQLLVVGSPGPVPHLELSDRHLLKQSQVHLSWSPAEDHNSPIEKYDIEFEDKEMAPEK
WFSLGKVPGNQTSTTLKLSPYVHYTFRVTAINKYGPGEPSPVSESVVTPEAAPEKNPVDV
RGEGNETNNMVITWKPLRWMDWNAPQIQYRVQWRPQGKQETWRKQTVSDPFLVVSNTSTF
VPYEIKVQAVNNQGKGPEPQVTIGYSGEDYPQVSPELEDITIFNSSTVLVRWRPVDLAQV
KGHLKGYNVTYWWKGSQRKHSKRHIHKSHIVVPANTTSAILSGLRPYSSYHVEVQAFNGR
GLGPASEWTFSTPEGVPGHPEALHLECQSDTSLLLHWQPPLSHNGVLTGYLLSYHPVEGE
SKEQLFFNLSDPELRTHNLTNLNPDLQYRFQLQATTQQGGPGEAIVREGGTMALFGKPDF
GNISATAGENYSVVSWVPRKGQCNFRFHILFKALPEGKVSPDHQPQPQYVSYNQSSYTQW
NLQPDTKYEIHLIKEKVLLHHLDVKTNGTGPVRVSTTGSFASEGWFIAFVSAIILLLLIL
LILCFIKRSKGGKYSVKDKEDTQVDSEARPMKDETFGEYRSLESDNEEKAFGSSQPSLNG
DIKPLGSDDSLADYGGSVDVQFNEDGSFIGQYSGKKEKEAAGGNDSSGATSPINPAVALE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Neural cell adhesion molecule L1 contains a PF00041 domain.

Neural cell adhesion molecule L1 contains a PF07679 domain.

Neural cell adhesion molecule L1 contains a PF07679 domain.

Neural cell adhesion molecule L1 contains a PF07679 domain.

Neural cell adhesion molecule L1 contains a PF07679 domain.

Neural cell adhesion molecule L1 contains a PF00047 domain.

Neural cell adhesion molecule L1 contains a PF00041 domain.

Neural cell adhesion molecule L1 contains a PF00041 domain.

Neural cell adhesion molecule L1 contains a PF00041 domain.

Neural cell adhesion molecule L1 is proteolytically cut by presenilin 1 (A22.001) cleavage..

Neural cell adhesion molecule L1 is proteolytically cut by ADAM10 peptidase (M12.210) cleavage..