L1 cell adhesion molecule

UniProt : Q6PGJ3, UniProt ID: Q6PGJ3_MOUSE,

L1 cell adhesion molecule

Mus musculus

MVVMLRYVWPLLLCSPCLLIQIPDEYKGHHVLEPPVITEQSPRRLVVFPTDDISLKCEAR
GRPQVEFRWTKDGIHFKPKEELGVVVHEAPYSGSFTIEGNNSFAQRFQGIYRCYASNKLG
TAMSHEIQLVAEGAPKWPKETVKPVEVEEGESVVLPCNPPPSAAPLRIYWMNSKILHIKQ
DERVSMGQNGDLYFANVLTSDNHSDYICNAHFPGTRTIIQKEPIDLRVKPTNSMIDRKPR
LLFPTNSSSRLVALQGQSLILECIAEGFPTPTIKWLHPSDPMPTDRVIYQNHNKTLQLLN
VGEEDDGEYTCLAENSLGSARHAYYVTVEAAPYWLQKPQSHLYGPGETARLDCQVQGRPQ
PEITWRINGMSMETVNKDQKYRIEQGSLILSNVQPSDTMVTQCEARNQHGLLLANAYIYV
VQLPARILTKDNQTYMAVEGSTAYLLCKAFGAPVPSVQWLDEEGTTVLQDERFFPYANGT
LSIRDLQANDTGRYFCQAANDQNNVTILANLQVKEATQITQGPRSAIEKKGARVTFTCQA
SFDPSLQASITWRGDGRDLQERGDSDKYFIEDGKLVIQSLDYSDQGNYSCVASTELDEVE
SRAQLLVVGSPGPVPHLELSDRHLLKQSQVHLSWSPAEDHNSPIEKYDIEFEDKEMAPEK
WFSLGKVPGNQTSTTLKLSPYVHYTFRVTAINKYGPGEPSPVSETVVTPEAAPEKNPVDV
RGEGNETNNMVITWKPLRWMDWNAPQIQYRVQWRPQGKQETWREQTVSDPFLVVSNTSTF
VPYEIKVQAVNNQGKGPEPQVTIGYSGEDYPQVSPELEDITIFNSSTVLVRWRPVDLAQV
KGHLKGYNVTYWWKGSQRKHSKRHIHKSHIVVPANTTSAILSGLRPYSSYHVEVQAFNGR
GLGPASEWTFSTPEGVPGHPEALHLECQSDTSLLLHWQPPLSHNGVLTGYLLSYHPVEGE
SKEQLFFNLSDPELRTHNLTNLNPDLQYRFQLQATTQQGPGEAIVREGGTMALFGKPDFG
NISATAGENYSVVSWVPRKGQCNFRFHILFKALPEGKVSPDHQPQPQYVSYNQSSYTQWN
LQPDTKYEIHLIKEKVLLHHLDVKTNGTGPVRVSTTGSFASEGWFIAFVSAIILLLLILL
ILCFIKRSKGGKYSVKDKEDTQVDSEARPMKDETFGEYRSLESDNEEKAFGSSQPSLNGD
IKPLGSDDSLADYGGSVDVQFNEDGSFIGQYSGKKEKEAAGGNDSSGATSPINPAVALE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

L1 cell adhesion molecule contains a PF00041 domain.

L1 cell adhesion molecule contains a PF00041 domain.

L1 cell adhesion molecule contains a PF00041 domain.

L1 cell adhesion molecule contains a PF00041 domain.

L1 cell adhesion molecule contains a PF00047 domain.

L1 cell adhesion molecule contains a PF07679 domain.

L1 cell adhesion molecule contains a PF07679 domain.

L1 cell adhesion molecule contains a PF07679 domain.

L1 cell adhesion molecule contains a PF07679 domain.

L1 cell adhesion molecule is proteolytically cut by neuropsin (S01.244) cleavage..