Protein kinase C, epsilon (Protein kinase C, epsilon, isoform CRA_b)

UniProt : B0LPH7, Q02156, UniProt ID: B0LPH7_HUMAN, KPCE_HUMAN,

Protein kinase C, epsilon (Protein kinase C, epsilon, isoform CRA_b)

Homo sapiens

MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKT
NSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLE
PEGRVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQP
TYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDQVGSQRFSVN
MPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIA
KVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPSEEDRSKSAPTSPCDQEIKELE
NNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQAKRLGLDEFNFIKVLGKGSFG
KVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKD
RLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILL
DAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEM
MAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGED
AIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQI
NQEEFKGFSYFGEDLMP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Protein kinase C, epsilon (Protein kinase C, epsilon, isoform CRA_b) contains a PF00069 domain.

Protein kinase C, epsilon (Protein kinase C, epsilon, isoform CRA_b) contains a PF00130 domain.

Protein kinase C, epsilon (Protein kinase C, epsilon, isoform CRA_b) contains a PF00433 domain.

Protein kinase C, epsilon (Protein kinase C, epsilon, isoform CRA_b) contains a PF00168 domain.

Protein kinase C, epsilon (Protein kinase C, epsilon, isoform CRA_b) contains a PF00130 domain.

Protein kinase C, epsilon (Protein kinase C, epsilon, isoform CRA_b) is proteolytically cut by calpain-2 (C02.002) cleavage..