Isoform 2 of Gelsolin

UniProt : A2A418, P06396, UniProt ID: A2A418_HUMAN, P06396-2,

Isoform 2 of Gelsolin

Homo sapiens

MVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYD
LHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGG
VASGFKHVVPNEVVVQRLFQVKGRRVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSN
SNRYERLKATQVSKGIRDNERSGRARVHVSEEGTEPEAMLQVLGPKPALPAGTEDTAKED
AANRKLAKLYKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQAN
TEERKAALKTASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKNWRDPDQTDGLGLSYLS
SHIANVERVPFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGG
DSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKE
PAHLMSLFGGKPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSN
DAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAY
RTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWV
GKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVD
PLDRAMAELAA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform 2 of Gelsolin contains a PF00626 domain.

Isoform 2 of Gelsolin contains a PF00626 domain.

Isoform 2 of Gelsolin contains a PF00626 domain.

Isoform 2 of Gelsolin contains a PF00626 domain.

Isoform 2 of Gelsolin contains a PF00626 domain.

Isoform 2 of Gelsolin contains a PF00626 domain.

Isoform 2 of Gelsolin is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. HIAN-VERV.

Isoform 2 of Gelsolin is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. AMAA-QHGM.