Endothelin 2

UniProt : P20800, Q5T1R3, UniProt ID: EDN2_HUMAN, Q5T1R3_HUMAN,

Endothelin 2

Homo sapiens

MVSVPTTWCSVALALLVALHEGKGQAAATLEQPASSSHAQGTHLRLRRCSCSSWLDKECV
YFCHLDIIWVNTPEQTAPYGLGNPPRRRRRSLPRRCQCSSARDPACATFCLRRPWTEAGA
VPSRKSPADVFQTGKTGATTGELLQRLRDISTVKSLFAKRQQEAMREPRSTHSRWRKR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Endothelin 2 contains a PF00322 domain.

Endothelin 2 is proteolytically cut by Kell blood-group protein (M13.090) cleavage. DIIW-VNTP.

Endothelin 2 is proteolytically cut by endothelin-converting enzyme 1 (M13.002) cleavage. DIIW-VNTP.