KLLA0E14939p

UniProt : Q6CN67, UniProt ID: Q6CN67_KLULA,

KLLA0E14939p

Kluyveromyces lactis

MVSTKSLFVFALSASAAFAAPAPGSKHIHRKEKRAAVTVTQYYDQNGNVIADPNAVATVP
VEAAAMQAASVVTSATSAAQTTLSPTSSAEEVTSSSSSSSSSSSSSSSSSSSSSSSTSTS
TSGSSSGIDGDLSDFSGPSEEFEDGTIPCSQFPSGQGVVAVDWIGLDGWSTIMDMDGETS
SSCEDGYYCSYACQAGMSKTQWPSEQPSDGKSIGGLLCKNGYLYRTNQDSKYLCEWGRQS
SYAVNNKDSAISLCRTDYPGSENMVVPTLVQPNSKKPISVVDEDSYYKWQGKSTSSQYYV
NNAGVSVEDGCIWGTDGSGVGNWAPVVLGAGYVNGITYLSIIPNPNNNEAPNYSIKIEAA
DGASVNGACSYIDGSYTGSGSDGCTVSVTSGTANFVFY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

KLLA0E14939p contains a PF03856 domain.

KLLA0E14939p is proteolytically cut by kexin (S08.070) cleavage. KEKR-AAVT.