Isoform 2 of Neuroendocrine protein 7B2
|
UniProt : P05408, Q6FHD0, UniProt ID: P05408-2, Q6FHD0_HUMAN, Isoform 2 of Neuroendocrine protein 7B2 Homo sapiens MVSRMVSTMLSGLLFWLASGWTPAFAYSPRTPDRVSEADIQRLLHGVMEQLGIARPRVEY PAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPC PVGKTDDGCLENTPDTAEFSREFQLHQHLFDPEHDYPGLGKWNKKLLYEKMKGGERRKRR SVNPYLQGQRLDNVVAKKSVPHFSDEDKDPE The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Isoform 2 of Neuroendocrine protein 7B2 contains a PF05281 domain.
Isoform 2 of Neuroendocrine protein 7B2 is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. VAKK-SVPH.
Isoform 2 of Neuroendocrine protein 7B2 is proteolytically cut by furin (S08.071) cleavage. RKRR-SVNP.