Putative uncharacterized protein

UniProt : P25206, Q3UI57, UniProt ID: MCM3_MOUSE, Q3UI57_MOUSE,

Putative uncharacterized protein

Mus musculus

MAGTVVLDDVELREAQRDYLDFLDDEEDQGIYQNKVRELISDNQYRLIVSVNDLRRKNEK
RANRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYIGLEGSFGSKHVSPRTLTSCF
LSCVVCVEGIVTKCSLVRPKVVRSVHYCPATKKTIERRYSDLTTLVAFPSSSVYPTKDEE
NNPLETEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDVILDDDLVDKVKPGDRIQVVGT
YRCLPGKKGCYTSGTFRTVLIACNVKQMSKDIQPAFSADDIAKIKKFSKTRSKDVFEQLA
RSLAPSIHGHDYVKKAILCLLLGGVERELENGSHIRGDINILLIGDPSVAKSQLLRYVLC
TAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRT
AIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFD
LLFIMLDQMDPEQDREISDHVLRMHQYRAPGEQDGDALPLGSSVDILATDDPDFTQDDQQ
DTRIYEKHDSLLHGTKKKKEKMVSAAFMKKYIHVAKIIKPTLTQESAAYIAEEYSRLRSQ
DSMSSDTARTSPVTARTLETLIRLATAHAKARMSKTVDLQDAEEAVELVQYAYFKKVLEK
EKKRKKASEDESDLEDEEEKSQEDTEQKRKRRKTHAKDGESYDPYDFSEAETQMPQVHTP
KTDDSQEKTDDSQETQDSQKVELSEPRLKAFKAALLEVFQEAHEQSVGMLHLTESINRNR
EEPFSSEEIQACLSRMQDDNQVMVSEGIVFLI

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein contains a PF00493 domain.

Putative uncharacterized protein is proteolytically cut by caspase-1 (C14.001) cleavage. LATD-DPDF.

Putative uncharacterized protein is proteolytically cut by caspase-1 (C14.001) cleavage. DDPD-FTQD.