Major pilin structural unit bundlin

UniProt : Q0H044, UniProt ID: Q0H044_ECOLX,

Major pilin structural unit bundlin

Escherichia coli

MVSKIMNKKYEKGLSLIESAMVLALAATVTAGVMFYYQSASDSNKSQNAISEVMSATSAI
NGLYIGQTSYSGLDSTILLNTSAIPDNYKDTTNKKITNPFGGELNVGPANNNTAFGYYLT
LTRLDKAACVSLATLNLGTSAKGYGVNISGENNITSFGNSADQAAKSTAITPAEAATACK
NTDSTNKVTYFMK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Major pilin structural unit bundlin contains a PF05307 domain.

Major pilin structural unit bundlin is proteolytically cut by type 4 prepilin peptidase 1 (A24.001) cleavage. YEKG-LSLI.