Major pilin structural unit bundlin
UniProt : Q0H044, UniProt ID: Q0H044_ECOLX, Major pilin structural unit bundlin Escherichia coli MVSKIMNKKYEKGLSLIESAMVLALAATVTAGVMFYYQSASDSNKSQNAISEVMSATSAI NGLYIGQTSYSGLDSTILLNTSAIPDNYKDTTNKKITNPFGGELNVGPANNNTAFGYYLT LTRLDKAACVSLATLNLGTSAKGYGVNISGENNITSFGNSADQAAKSTAITPAEAATACK NTDSTNKVTYFMK The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Major pilin structural unit bundlin contains a PF05307 domain.
Major pilin structural unit bundlin is proteolytically cut by type 4 prepilin peptidase 1 (A24.001) cleavage. YEKG-LSLI.