Candidapepsin-8

UniProt : O42778, UniProt ID: CARP8_CANAL,

Candidapepsin-8

Candida albicans

MVSIITFTKNVLVTLAFALLAQGLAIPEDIDKRAEKVVSLDFTVTRKPFNATAHGQHHQS
QQQQQQQQQQPAQKRGTVQTSLINEGPSYAATITVGSNKQQQTVIVDTGSSDLWVVDSAA
VCQVTYPGQSPTFCKQDGTYKPSSSTTSQNLGKAFSIRYEDGSSSQGTVYKDTIGLGGAS
ITNQQFADVTTTSVDQGILGIGFTGDESSPTYDNVPVTLKKQGIINKNAYSLYLNSASAS
SGTIIFGGVDNAKYTGSLTALPITSSNELRVQLSTINIAGTTVSASTTPVLDSGTTLTYF
SQTIADKLAAAVGAKWNSYYQLYTSSCNLAGNIVFNFAKGVTISVPLSEFVLQDGNSCYF
GVSRDSATILGDNFLRRAYAVYDLDGNTISLAQVKYTTSSSISTL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Candidapepsin-8 contains a PF00026 domain.

Candidapepsin-8 is proteolytically cut by kexin (S08.070) cleavage. AQKR-GTVQ.

Candidapepsin-8 is proteolytically cut by kexin (S08.070) cleavage. IDKR-AEKV.