Protein alpha

UniProt : P04329, UniProt ID: COAT_BBV,

Protein alpha

Black beetle virus

MVRNNNRRRQRTQRIVTTTTQTAPVPQQNVPKQPRRRRNRARRNRRQGRAMNMGALTRLS
QPGLAFLKCAFAPPDFNTDPGKGIPDRFEGKVVTRKDVLNQSINFTANRDTFILIAPTPG
VAYWVADVPAGTFPISTTTFNAVNFPGFNSMFGNAAASRSDQVSSFRYASMNVGIYPTSN
LMQFAGSITVWKCPVKLSNVQFPVATTPATSALVHTLVGLDGVLAVGPDNFSESFIKGVF
SQSVCNEPDFEFSDILEGIQTLPPANVTVATSGQPFNLAAGAEAVSGIVGWGNMDTIVIR
VSAPTGAVNSAILKTWACLEYRPNPNAMLYQFGHDSPPCDEVALQEYRTVARSLPVAVIA
AQNASMWERVKSIIKSSLAMASNVPGPIGIAASGLSGLSALFEGFGF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Protein alpha contains a PF01829 domain.

Protein alpha is proteolytically cut by nodavirus peptidase (A06.001) cleavage. AAQN-ASMW.